KLF13 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17158
Article Name: KLF13 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17158
Supplier Catalog Number: A17158
Alternative Catalog Number: ABB-A17158-100UL,ABB-A17158-20UL,ABB-A17158-1000UL,ABB-A17158-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: BTEB3, FKLF2, NSLP1, RFLAT1, RFLAT-1, KLF13
KLF13 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes (Scohy et al., 2000 [PubMed 11087666]).
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 51621
UniProt: Q9Y2Y9
Purity: Affinity purification
Sequence: PPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS
Target: KLF13
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using KLF13 Rabbit pAb (A17158) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.