SNRK Rabbit pAb, Polyclonal

Catalog Number: ABB-A17171
Article Name: SNRK Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17171
Supplier Catalog Number: A17171
Alternative Catalog Number: ABB-A17171-20UL,ABB-A17171-100UL,ABB-A17171-500UL,ABB-A17171-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: HSNFRK, SNRK
SNRK is a member of the sucrose nonfermenting (SNF)-related kinase family of serine/threonine kinases (Kertesz et al., 2002 [PubMed 12234663]).
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 54861
UniProt: Q9NRH2
Purity: Affinity purification
Sequence: LKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSK
Target: SNRK
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Endocrine Metabolism,Cardiovascular,Heart. Shipping: Ice Bag
Western blot analysis of various lysates using SNRK Rabbit pAb (A17171) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.