TMEM165 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17183
Article Name: TMEM165 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17183
Supplier Catalog Number: A17183
Alternative Catalog Number: ABB-A17183-20UL,ABB-A17183-100UL,ABB-A17183-1000UL,ABB-A17183-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: FT27, GDT1, CDG2K, TPARL, TMPT27, SLC64A1, TMEM165
This gene encodes a predicted transmembrane protein with a perinuclear Golgi-like distribution in fibroblasts. Mutations in this gene are associated with the autosomal recessive disorder congenital disorder of glycosylation, type IIk. Knockdown of this genes expression causes decreased sialylation in HEK cells and suggests this gene plays a role in terminal Golgi glycosylation. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 55858
UniProt: Q9HC07
Purity: Affinity purification
Sequence: IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL
Target: TMEM165
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using TMEM165 Rabbit pAb (A17183) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5min.