PHRF1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17192
Article Name: PHRF1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17192
Supplier Catalog Number: A17192
Alternative Catalog Number: ABB-A17192-100UL,ABB-A17192-20UL,ABB-A17192-1000UL,ABB-A17192-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: RNF221, PPP1R125, PHRF1
Predicted to enable RNA polymerase binding activity. Predicted to be involved in mRNA processing and transcription by RNA polymerase II. Located in membrane.
Clonality: Polyclonal
Molecular Weight: 179kDa
NCBI: 57661
UniProt: Q9P1Y6
Purity: Affinity purification
Sequence: KAEAPSSPDVAPAGKEDSPSASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQVFSELP
Target: PHRF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using PHRF1 Rabbit pAb (A17192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.