CYBRD1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17215
Article Name: CYBRD1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17215
Supplier Catalog Number: A17215
Alternative Catalog Number: ABB-A17215-20UL,ABB-A17215-100UL,ABB-A17215-1000UL,ABB-A17215-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: DCYTB, FRRS3, CYB561A2, CYBRD1
This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 79901
UniProt: Q53TN4
Purity: Affinity purification
Sequence: IFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Target: CYBRD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using CYBRD1 Rabbit pAb (A17215) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.