MIXL1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17223
Article Name: MIXL1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17223
Supplier Catalog Number: A17223
Alternative Catalog Number: ABB-A17223-20UL,ABB-A17223-100UL,ABB-A17223-1000UL,ABB-A17223-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: MIX, MIXL, MILD1, MIXL1
Enables RNA polymerase II-specific DNA-binding transcription factor binding activity and sequence-specific double-stranded DNA binding activity. Predicted to be involved in several processes, including endodermal cell differentiation, hematopoietic progenitor cell differentiation, and positive regulation of mesoderm development. Predicted to act upstream of or within cell migration involved in gastrulation and hemopoiesis. Located in nucleoplasm.
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 83881
UniProt: Q9H2W2
Purity: Affinity purification
Sequence: QPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
Target: MIXL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using MIXL1 Rabbit pAb (A17223) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.