GORAB Rabbit pAb, Polyclonal

Catalog Number: ABB-A17245
Article Name: GORAB Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17245
Supplier Catalog Number: A17245
Alternative Catalog Number: ABB-A17245-100UL,ABB-A17245-20UL,ABB-A17245-500UL,ABB-A17245-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: GO, NTKLBP1, SCYL1BP1, GORAB
This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 92344
UniProt: Q5T7V8
Purity: Affinity purification
Sequence: MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV
Target: GORAB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using GORAB Rabbit pAb (A17245) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.