PGA3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17321
Article Name: PGA3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17321
Supplier Catalog Number: A17321
Alternative Catalog Number: ABB-A17321-100UL,ABB-A17321-20UL,ABB-A17321-1000UL,ABB-A17321-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PGA3
This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the active enzyme, which functions in the digestion of dietary proteins. This gene is found in a cluster of related genes on chromosome 11, each of which encodes one of multiple pepsinogens. Pepsinogen levels in serum may serve as a biomarker for atrophic gastritis and gastric cancer.
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 643834
UniProt: P0DJD8
Purity: Affinity purification
Sequence: VDEQPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFD
Target: PGA3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of various lysates using PGA3 Rabbit pAb (A17321) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.