ARSA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1736
Article Name: ARSA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1736
Supplier Catalog Number: A1736
Alternative Catalog Number: ABB-A1736-20UL,ABB-A1736-100UL,ABB-A1736-1000UL,ABB-A1736-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ASA, MLD, ARSA
The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 410
UniProt: P15289
Purity: Affinity purification
Sequence: LMADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLL
Target: ARSA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of various lysates using ARSA Rabbit pAb (A1736) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.