RUNX1T1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1737
- Images (1)
| Article Name: | RUNX1T1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1737 |
| Supplier Catalog Number: | A1737 |
| Alternative Catalog Number: | ABB-A1737-100UL,ABB-A1737-20UL,ABB-A1737-1000UL,ABB-A1737-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CDR, ETO, MTG8, AML1T1, ZMYND2, CBFA2T1, AML1-MTG8, RUNX1T1 |
| This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8,21)(q22,q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5-region of the runt-related transcription factor 1 gene fused to the 3-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 68kDa |
| NCBI: | 862 |
| UniProt: | Q06455 |
| Purity: | Affinity purification |
| Sequence: | ENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLK |
| Target: | RUNX1T1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor suppressors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat brain, using RUNX1T1 Rabbit pAb (A1737) at 1:600 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
