JNK3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17408
Article Name: JNK3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17408
Supplier Catalog Number: A17408
Alternative Catalog Number: ABB-A17408-20UL,ABB-A17408-100UL,ABB-A17408-500UL,ABB-A17408-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 5602
UniProt: P53779
Purity: Affinity purification
Sequence: NRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN
Target: MAPK10
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,ErbB-HER Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,TGF-b-Smad Signaling Pathway,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates using JNK3 Rabbit pAb (A17408) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.