TRPM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17509
Article Name: TRPM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17509
Supplier Catalog Number: A17509
Alternative Catalog Number: ABB-A17509-100UL,ABB-A17509-20UL,ABB-A17509-500UL,ABB-A17509-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MLSN1, CSNB1C, LTRPC1, TRPM1
This gene encodes a member of the transient receptor potential melastatin subfamily of transient receptor potential ion channels. The encoded protein is a calcium permeable cation channel that is expressed in melanocytes and may play a role in melanin synthesis. Specific mutations in this gene are the cause autosomal recessive complete congenital stationary night blindness-1C. The expression of this protein is inversely correlated with melanoma aggressiveness and as such it is used as a prognostic marker for melanoma metastasis. Alternate splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 182kDa
NCBI: 4308
UniProt: Q7Z4N2
Purity: Affinity purification
Sequence: SITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPD
Target: TRPM1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of lysates from SK-MEL-28 cells, using TRPM1 Rabbit pAb (A17509) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.