SRPK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17536
Article Name: SRPK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17536
Supplier Catalog Number: A17536
Alternative Catalog Number: ABB-A17536-100UL,ABB-A17536-20UL,ABB-A17536-1000UL,ABB-A17536-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SFRSK2, SRPK2
Enables ATP binding activity, magnesium ion binding activity, and protein serine/threonine kinase activity. Involved in several processes, including nucleic acid metabolic process, peptidyl-serine phosphorylation, and regulation of viral genome replication. Located in chromatin, cytosol, and nuclear lumen.
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 6733
UniProt: P78362
Purity: Affinity purification
Sequence: NAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRN
Target: SRPK2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using SRPK2 Rabbit pAb (A17536) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.