TNFAIP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17543
Article Name: TNFAIP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17543
Supplier Catalog Number: A17543
Alternative Catalog Number: ABB-A17543-100UL,ABB-A17543-20UL,ABB-A17543-500UL,ABB-A17543-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: B12, B61, EDP1, BTBD34, hBACURD2, TNFAIP1
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 7126
UniProt: Q13829
Purity: Affinity purification
Sequence: DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL
Target: TNFAIP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag
Western blot analysis of lysates from K-562 cells, using TNFAIP1 Rabbit pAb (A17543) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.