ZIC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17547
Article Name: ZIC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17547
Supplier Catalog Number: A17547
Alternative Catalog Number: ABB-A17547-20UL,ABB-A17547-100UL,ABB-A17547-1000UL,ABB-A17547-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZIC, CRS6, BAIDCS, ZNF201, ZIC1
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 7545
UniProt: Q15915
Purity: Affinity purification
Sequence: LFAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA
Target: ZIC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using ZIC1 Rabbit pAb (A17547) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.