UBE4B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17609
Article Name: UBE4B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17609
Supplier Catalog Number: A17609
Alternative Catalog Number: ABB-A17609-20UL,ABB-A17609-100UL,ABB-A17609-1000UL,ABB-A17609-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: E4, UFD2, HDNB1, UBOX3, UFD2A, UBE4B
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 146kDa
NCBI: 10277
UniProt: O95155
Purity: Affinity purification
Sequence: EVDENDRREKRSLSDKEPSSGPEVSEEQALQLVCKIFRVSWKDRDRDVIFLSSLSAQFKQNPKEVFSDFKDLIGQILMEVLMMSTQTRDENPFASLTATSQPIAAAARSPDRNLLLNTGSN
Target: UBE4B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using UBE4B Rabbit pAb (A17609) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.