ABLIM3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17643
- Images (1)
| Article Name: | ABLIM3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17643 |
| Supplier Catalog Number: | A17643 |
| Alternative Catalog Number: | ABB-A17643-20UL,ABB-A17643-100UL,ABB-A17643-500UL,ABB-A17643-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | HMFN1661, ABLIM3 |
| This gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients. |
| Clonality: | Polyclonal |
| Molecular Weight: | 78kDa |
| NCBI: | 22885 |
| UniProt: | O94929 |
| Purity: | Affinity purification |
| Sequence: | TSEDISQTSKYSPIYSPDPYYASESEYWTYHGSPKVPRARRFSSGGEEDDFDRSMHKLQSGIGRLILKEEMKARSSSYADPWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSADLFHYDSMNAVNWGMREYKIYPYELLLVTTR |
| Target: | ABLIM3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ABLIM3 Rabbit pAb (A17643) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
