USP22 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17663
Article Name: USP22 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17663
Supplier Catalog Number: A17663
Alternative Catalog Number: ABB-A17663-20UL,ABB-A17663-100UL,ABB-A17663-1000UL,ABB-A17663-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: USP3L, USP22
Enables enzyme binding activity, nuclear receptor coactivator activity, and thiol-dependent deubiquitinase. Contributes to H4 histone acetyltransferase activity. Involved in positive regulation of mitotic cell cycle, positive regulation of transcription, DNA-templated, and protein modification by small protein conjugation or removal. Part of SAGA complex.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 23326
UniProt: Q9UPT9
Purity: Affinity purification
Sequence: TAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEP
Target: USP22
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using USP22 Rabbit pAb (A17663) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.