RAB3GAP2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17669
- Images (1)
| Article Name: | RAB3GAP2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17669 |
| Supplier Catalog Number: | A17669 |
| Alternative Catalog Number: | ABB-A17669-20UL,ABB-A17669-100UL,ABB-A17669-1000UL,ABB-A17669-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | p150, SPG69, MARTS1, WARBM2, RAB3GAP150, RAB3-GAP150, RAB3GAP2 |
| The protein encoded by this gene belongs to the RAB3 protein family, members of which are involved in regulated exocytosis of neurotransmitters and hormones. This protein forms the Rab3 GTPase-activating complex with RAB3GAP1, where it constitutes the regulatory subunit, whereas the latter functions as the catalytic subunit. This gene has the highest level of expression in the brain, consistent with it having a key role in neurodevelopment. Mutations in this gene are associated with Martsolf syndrome. |
| Clonality: | Polyclonal |
| Molecular Weight: | 156kDa |
| NCBI: | 25782 |
| UniProt: | Q9H2M9 |
| Purity: | Affinity purification |
| Sequence: | MACSIVQFCYFQDLQAARDFLFPHLREEILSGALRRDPSKSTDWEDDGWGAWEENEPQEPEEEGNTCKTQKTSWLQDCVLSLSPTNDLMVIAREQKAVFLVPKWKYSDKGKEEMQFAVGWSGSLNVEEGECVTSALCIPLASQKRSSTGRPDWTCIVVGFTSGYVRFYTENGVLLLAQLLNEDPVLQLKCRTYEIPRHPG |
| Target: | RAB3GAP2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RAB3GAP2 Rabbit pAb (A17669) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
