DECR2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17675
Article Name: DECR2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17675
Supplier Catalog Number: A17675
Alternative Catalog Number: ABB-A17675-100UL,ABB-A17675-20UL,ABB-A17675-500UL,ABB-A17675-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PDCR, SDR17C1, DECR2
Enables 2,4-dienoyl-CoA reductase (NADPH) activity and trans-2-enoyl-CoA reductase (NADPH) activity. Involved in unsaturated fatty acid biosynthetic process. Predicted to be located in peroxisome.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 26063
UniProt: Q9NUI1
Purity: Affinity purification
Sequence: GTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLG
Target: DECR2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using DECR2 Rabbit pAb (A17675) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.