CPA4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17701
- Images (1)
| Article Name: | CPA4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17701 |
| Supplier Catalog Number: | A17701 |
| Alternative Catalog Number: | ABB-A17701-20UL,ABB-A17701-100UL,ABB-A17701-500UL,ABB-A17701-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CPA3, CPA4 |
| This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. |
| Clonality: | Polyclonal |
| Molecular Weight: | 47kDa |
| NCBI: | 51200 |
| UniProt: | Q9UI42 |
| Purity: | Affinity purification |
| Sequence: | SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP |
| Target: | CPA4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CPA4 Rabbit pAb (A17701) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
