DCDC2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17704
- Images (1)
| Article Name: | DCDC2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17704 |
| Supplier Catalog Number: | A17704 |
| Alternative Catalog Number: | ABB-A17704-100UL,ABB-A17704-20UL,ABB-A17704-1000UL,ABB-A17704-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | NSC, RU2, RU2S, DCDC2A, DFNB66, NPHP19, DCDC2 |
| This gene encodes a doublecortin domain-containing family member. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. This family member is thought to function in neuronal migration where it may affect the signaling of primary cilia. Mutations in this gene have been associated with reading disability (RD) type 2, also referred to as developmental dyslexia. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 53kDa |
| NCBI: | 51473 |
| UniProt: | Q9UHG0 |
| Purity: | Affinity purification |
| Sequence: | MSGSSARSSHLSQPVVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQEAFKKLNYLDIGEIKKRPMEVVNTEVKPVIHSRINVSARFRKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELLFDKSTMRRPFGQKASSLPPIVGSRKS |
| Target: | DCDC2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microtubules,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DCDC2 Rabbit pAb (A17704) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3min. |
Product Guarantee and Expert Support
