PAK1IP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17713
Article Name: PAK1IP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17713
Supplier Catalog Number: A17713
Alternative Catalog Number: ABB-A17713-100UL,ABB-A17713-20UL,ABB-A17713-500UL,ABB-A17713-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PIP1, MAK11, WDR84, hPIP1, bA421M1.5, PAK1IP1
Involved in regulation of signal transduction by p53 class mediator and ribosomal large subunit biogenesis. Located in nucleolus.
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 55003
UniProt: Q9NWT1
Purity: Affinity purification
Sequence: MELVAGCYEQVLFGFAVHPEPEACGDHEQWTLVADFTHHAHTASLSAVAVNSRFVVTGSKDETIHIYDMKKKIEHGALVHHSGTITCLKFYGNRHLISGAEDGLICIWDAKKWECLKSIKAHKGQVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSPRGEQYVVIIQNKIDIYQLDTASISGTITNEKRISSVKFLSESVLAVAGDEEVIRFFDCDSLVCLCEFKAHENRVKDMFSFE
Target: PAK1IP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using PAK1IP1 Rabbit pAb (A17713) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.