HMBS Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1777
- Images (1)
| Article Name: | HMBS Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1777 |
| Supplier Catalog Number: | A1777 |
| Alternative Catalog Number: | ABB-A1777-100UL,ABB-A1777-20UL,ABB-A1777-500UL,ABB-A1777-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | UPS, PBGD, PORC, PBG-D, HMBS |
| This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Clonality: | Polyclonal |
| Molecular Weight: | 39kDa |
| NCBI: | 3145 |
| UniProt: | P08397 |
| Purity: | Affinity purification |
| Sequence: | MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLR |
| Target: | HMBS |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HMBS Rabbit pAb (A1777) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
