ZNF768 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17771
Article Name: ZNF768 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17771
Supplier Catalog Number: A17771
Alternative Catalog Number: ABB-A17771-100UL,ABB-A17771-20UL,ABB-A17771-1000UL,ABB-A17771-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZNF768
Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 79724
UniProt: Q9H5H4
Purity: Affinity purification
Sequence: PGYESESSRYESQNTELKTQSPEFEAQSSKFQEGAEMLLNPEEKSPLNISVGVHPLDSFTQGFGEQPTGDLPIGPPFEMPTGALLSTPQFEMLQNPLGLTGALRGPGRRGGRARGGQGPRPNICGICGKSF
Target: ZNF768
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using ZNF768 Rabbit pAb (A17771) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.