ZNF768 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17771
| Article Name: |
ZNF768 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
ABB-A17771 |
| Supplier Catalog Number: |
A17771 |
| Alternative Catalog Number: |
ABB-A17771-100UL,ABB-A17771-20UL,ABB-A17771-1000UL,ABB-A17771-500UL |
| Manufacturer: |
ABclonal |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ZNF768 |
| Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. |
| Clonality: |
Polyclonal |
| Molecular Weight: |
60kDa |
| NCBI: |
79724 |
| UniProt: |
Q9H5H4 |
| Purity: |
Affinity purification |
| Sequence: |
PGYESESSRYESQNTELKTQSPEFEAQSSKFQEGAEMLLNPEEKSPLNISVGVHPLDSFTQGFGEQPTGDLPIGPPFEMPTGALLSTPQFEMLQNPLGLTGALRGPGRRGGRARGGQGPRPNICGICGKSF |
| Target: |
ZNF768 |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: |
Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
Western blot analysis of lysates from Mouse liver, using ZNF768 Rabbit pAb (A17771) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |