ABLIM2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A17792
- Images (1)
| Article Name: | ABLIM2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A17792 |
| Supplier Catalog Number: | A17792 |
| Alternative Catalog Number: | ABB-A17792-20UL,ABB-A17792-100UL,ABB-A17792-500UL,ABB-A17792-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ABLIM2 |
| Predicted to enable actin filament binding activity. Predicted to be involved in lamellipodium assembly. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II. Located in actin cytoskeleton. |
| Clonality: | Polyclonal |
| Molecular Weight: | 68kDa |
| NCBI: | 84448 |
| UniProt: | Q6H8Q1 |
| Purity: | Affinity purification |
| Sequence: | DYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIYAKLGGEILD |
| Target: | ABLIM2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Microfilaments. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat lung, using ABLIM2 Rabbit pAb (A17792) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
