PGLYRP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17814
Article Name: PGLYRP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17814
Supplier Catalog Number: A17814
Alternative Catalog Number: ABB-A17814-20UL,ABB-A17814-100UL,ABB-A17814-500UL,ABB-A17814-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: tagL, PGRPL, PGRP-L, PGLYRPL, HMFT0141, TAGL-like, tagl-beta, tagL-alpha, PGLYRP2
This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 114770
UniProt: Q96PD5
Purity: Affinity purification
Sequence: LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
Target: PGLYRP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using PGLYRP2 Rabbit pAb (A17814) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.