MIB2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17829
Article Name: MIB2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17829
Supplier Catalog Number: A17829
Alternative Catalog Number: ABB-A17829-20UL,ABB-A17829-100UL,ABB-A17829-1000UL,ABB-A17829-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZZZ5, ZZANK1, MIB2
The protein encoded by this gene is an E3 ubiquitin protein ligase that mediates ubiquitination of proteins in the Notch signaling pathway. The encoded protein may be a suppressor of melanoma invasion.
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 142678
UniProt: Q96AX9
Purity: Affinity purification
Sequence: ASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLR
Target: MIB2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology,Notch Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using MIB2 Rabbit pAb (A17829) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.