A2ML1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17831
Article Name: A2ML1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17831
Supplier Catalog Number: A17831
Alternative Catalog Number: ABB-A17831-100UL,ABB-A17831-20UL,ABB-A17831-1000UL,ABB-A17831-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: OMS, p170, CPAMD9, A2ML1
This gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP, PMID:20805888). Mutations in these gene have also been associated with some cases of Noonan syndrome (NS, PMID:24939586) as well as some cases of otitis media (PMID:26121085). Alternative splicing results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 161kDa
NCBI: 144568
UniProt: A8K2U0
Purity: Affinity purification
Sequence: PFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPADASPDQEISFSYYLIGKGSLV
Target: A2ML1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Ubiquitin,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using A2ML1 Rabbit pAb (A17831) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.