Caspase-6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1784
Article Name: Caspase-6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1784
Supplier Catalog Number: A1784
Alternative Catalog Number: ABB-A1784-100UL,ABB-A1784-20UL,ABB-A1784-1000UL,ABB-A1784-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MCH2, CSP-6, caspase-6, Caspase-6
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 839
UniProt: P55212
Purity: Affinity purification
Sequence: AASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Target: CASP6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag
Western blot analysis of various lysates using Caspase-6 Rabbit pAb (A1784) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.