CCDC137 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17856
Article Name: CCDC137 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17856
Supplier Catalog Number: A17856
Alternative Catalog Number: ABB-A17856-20UL,ABB-A17856-100UL,ABB-A17856-1000UL,ABB-A17856-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RaRF, CCDC137
Enables RNA binding activity. Located in chromosome and fibrillar center.
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 339230
UniProt: Q6PK04
Purity: Affinity purification
Sequence: QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
Target: CCDC137
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using CCDC137 Rabbit pAb (A17856) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.