USP12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A17862
Article Name: USP12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A17862
Supplier Catalog Number: A17862
Alternative Catalog Number: ABB-A17862-100UL,ABB-A17862-20UL,ABB-A17862-1000UL,ABB-A17862-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UBH1, USP12L1, USP12
Enables cysteine-type endopeptidase activity and thiol-dependent deubiquitinase. Involved in protein deubiquitination. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus.
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 219333
UniProt: O75317
Purity: Affinity purification
Sequence: MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGV
Target: USP12
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using USP12 Rabbit pAb (A17862) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 2min.