SSR3 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17873
Article Name: SSR3 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17873
Supplier Catalog Number: A17873
Alternative Catalog Number: ABB-A17873-20UL,ABB-A17873-100UL,ABB-A17873-500UL,ABB-A17873-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: TRAPG, SSR3
The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR is comprised of four membrane proteins/subunits: alpha, beta, gamma, and delta. The first two are glycosylated subunits and the latter two are non-glycosylated subunits. This gene encodes the gamma subunit, which is predicted to span the membrane four times.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 6747
UniProt: Q9UNL2
Purity: Affinity purification
Sequence: TYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLF
Target: SSR3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using SSR3 Rabbit pAb (A17873) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.