OVOL2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A17973
Article Name: OVOL2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A17973
Supplier Catalog Number: A17973
Alternative Catalog Number: ABB-A17973-100UL,ABB-A17973-20UL,ABB-A17973-1000UL,ABB-A17973-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: CHED, CHED1, CHED2, PPCD1, ZNF339, EUROIMAGE566589, OVOL2
This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy.
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 58495
UniProt: Q9BRP0
Purity: Affinity purification
Sequence: DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ
Target: OVOL2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Stem Cells,Germline Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using OVOL2 Rabbit pAb (A17973) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.