ALG13 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18115
Article Name: ALG13 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18115
Supplier Catalog Number: A18115
Alternative Catalog Number: ABB-A18115-100UL,ABB-A18115-20UL,ABB-A18115-1000UL,ABB-A18115-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: CDG1S, DEE36, EIEE36, MDS031, TDRD13, CXorf45, GLT28D1, YGL047W, ALG13
The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linked glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 79868
UniProt: Q9NP73
Purity: Affinity purification
Sequence: VVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
Target: ALG13
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using ALG13 Rabbit pAb (A18115) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.