RXRB Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18119
- Images (1)
| Article Name: | RXRB Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18119 |
| Supplier Catalog Number: | A18119 |
| Alternative Catalog Number: | ABB-A18119-100UL,ABB-A18119-20UL,ABB-A18119-500UL,ABB-A18119-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Alternative Names: | NR2B2, DAUDI6, RCoR-1, RXRbeta, H-2RIIBP, RXR-beta, RXRB |
| This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 6257 |
| UniProt: | P28702 |
| Purity: | Affinity purification |
| Sequence: | AGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGL |
| Target: | RXRB |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RXRB Rabbit pAb (A18119) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
