SMG5 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18123
Article Name: SMG5 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18123
Supplier Catalog Number: A18123
Alternative Catalog Number: ABB-A18123-100UL,ABB-A18123-20UL,ABB-A18123-500UL,ABB-A18123-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: EST1B, SMG-5, LPTSRP1, LPTS-RP1, SMG5
SMG5 is involved in nonsense-mediated mRNA decay (Ohnishi et al., 2003 [PubMed 14636577]).
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 23381
UniProt: Q9UPR3
Purity: Affinity purification
Sequence: DSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
Target: SMG5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using SMG5 Rabbit pAb (A18123) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.