ANGPTL8 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18133
- Images (1)
| Article Name: | ANGPTL8 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18133 |
| Supplier Catalog Number: | A18133 |
| Alternative Catalog Number: | ABB-A18133-20UL,ABB-A18133-100UL,ABB-A18133-500UL,ABB-A18133-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | RIFL, TD26, PRO1185, PVPA599, C19orf80, ANGPTL8 |
| Predicted to enable hormone activity. Involved in regulation of lipid metabolic process and triglyceride homeostasis. Acts upstream of or within positive regulation of protein processing and regulation of lipoprotein metabolic process. Located in extracellular region. |
| Clonality: | Polyclonal |
| Molecular Weight: | 22kDa |
| NCBI: | 55908 |
| UniProt: | Q6UXH0 |
| Purity: | Affinity purification |
| Sequence: | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
| Target: | ANGPTL8 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using ANGPTL8 Rabbit pAb (A18133) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
