OSR2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18178
Article Name: OSR2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18178
Supplier Catalog Number: A18178
Alternative Catalog Number: ABB-A18178-100UL,ABB-A18178-20UL,ABB-A18178-1000UL,ABB-A18178-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: OSR2
OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 [PubMed 15175245]).
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 116039
UniProt: Q8N2R0
Purity: Affinity purification
Sequence: HMQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLRRHSLTHTPRQDF
Target: OSR2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using OSR2 Rabbit pAb (A18178) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.