BTBD7 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18206
Article Name: BTBD7 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18206
Supplier Catalog Number: A18206
Alternative Catalog Number: ABB-A18206-100UL,ABB-A18206-20UL,ABB-A18206-1000UL,ABB-A18206-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: FUP1, BTBD7
Predicted to be involved in regulation of branching involved in salivary gland morphogenesis. Predicted to be located in nucleus.
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 55727
UniProt: Q9P203
Purity: Affinity purification
Sequence: ASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKFIKRRK
Target: BTBD7
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of various lysates using BTBD7 Rabbit pAb (A18206) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.