THPO Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1825
- Images (1)
| Article Name: | THPO Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1825 |
| Supplier Catalog Number: | A1825 |
| Alternative Catalog Number: | ABB-A1825-100UL,ABB-A1825-20UL,ABB-A1825-500UL,ABB-A1825-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ML, TPO, MGDF, MKCSF, MPLLG, THCYT1, THPO |
| Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5 UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. |
| Clonality: | Polyclonal |
| Molecular Weight: | 38kDa |
| NCBI: | 7066 |
| UniProt: | P40225 |
| Purity: | Affinity purification |
| Sequence: | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSD |
| Target: | THPO |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Growth factors,Immunology Inflammation,Cytokines,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using THPO Rabbit pAb (A1825) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
