RMND1 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18254
- Images (1)
| Article Name: | RMND1 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18254 |
| Supplier Catalog Number: | A18254 |
| Alternative Catalog Number: | ABB-A18254-20UL,ABB-A18254-100UL,ABB-A18254-1000UL,ABB-A18254-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | RMD1, C6orf96, COXPD11, bA351K16, bA351K16.3, RMND1 |
| The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this gene are associated with combined oxidative phosphorylation deficiency-11. Alternatively spliced transcript variants have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 52kDa |
| NCBI: | 55005 |
| UniProt: | Q9NWS8 |
| Purity: | Affinity purification |
| Sequence: | HHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVT |
| Target: | RMND1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat brain, using RMND1 Rabbit pAb (A18254) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
