GYPA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A1827
Article Name: GYPA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A1827
Supplier Catalog Number: A1827
Alternative Catalog Number: ABB-A1827-20UL,ABB-A1827-100UL,ABB-A1827-1000UL,ABB-A1827-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MN, GPA, MNS, GPSAT, PAS-2, CD235a, GPErik, HGpMiV, HGpMiXI, HGpSta(C), GYPA
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 2993
UniProt: P02724
Purity: Affinity purification
Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Target: GYPA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using GYPA Rabbit pAb (A1827) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.