PEX11B Rabbit pAb, Polyclonal

Catalog Number: ABB-A18321
Article Name: PEX11B Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18321
Supplier Catalog Number: A18321
Alternative Catalog Number: ABB-A18321-100UL,ABB-A18321-20UL,ABB-A18321-1000UL,ABB-A18321-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: PEX14B, PEX11beta, PEX11-BETA, PEX11B
The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 8799
UniProt: O96011
Purity: Affinity purification
Sequence: DNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG
Target: PEX11B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using PEX11B Rabbit pAb (A18321) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.