PRK2/PKN2 Rabbit pAb, Polyclonal

Catalog Number: ABB-A18373
Article Name: PRK2/PKN2 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A18373
Supplier Catalog Number: A18373
Alternative Catalog Number: ABB-A18373-20UL,ABB-A18373-100UL,ABB-A18373-500UL,ABB-A18373-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: PAK2, PRK2, STK7, Pak-2, PRKCL2, PRO2042, PRK2/PKN2
Enables RNA polymerase binding activity, histone deacetylase binding activity, and protein serine/threonine kinase activity. Involved in several processes, including apical junction assembly, positive regulation of cell cycle, and positive regulation of viral genome replication. Located in several cellular components, including cleavage furrow, cytoskeleton, and midbody.
Clonality: Polyclonal
Molecular Weight: 112kDa
NCBI: 5586
UniProt: Q16513
Purity: Affinity purification
Sequence: GQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVD
Target: PKN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using PRK2/PRK2/PKN2 Rabbit pAb (A18373) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.