SLC5A3 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18380
- Images (1)
| Article Name: | SLC5A3 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18380 |
| Supplier Catalog Number: | A18380 |
| Alternative Catalog Number: | ABB-A18380-20UL,ABB-A18380-100UL,ABB-A18380-500UL,ABB-A18380-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | BCW2, SMIT, SMIT1, SMIT2, SLC5A3 |
| Enables potassium channel regulator activity and transmembrane transporter binding activity. Predicted to be involved in inositol metabolic process, monosaccharide transmembrane transport, and myo-inositol import across plasma membrane. Predicted to act upstream of or within several processes, including peripheral nervous system development, positive regulation of reactive oxygen species biosynthetic process, and regulation of respiratory gaseous exchange. Located in plasma membrane. Part of perinuclear region of cytoplasm. |
| Clonality: | Polyclonal |
| Molecular Weight: | 80kDa |
| NCBI: | 6526 |
| UniProt: | P53794 |
| Purity: | Affinity purification |
| Sequence: | PPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGEKERKKETDDGGRYWKFIDWFCGFKSKSLSKRSLRDLMEEEAVCLQMLEETRQVK |
| Target: | SLC5A3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse brain usingSLC5A3 Rabbit pAb (A18380) at1:2000 dilution. Secondary antibody:(AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
