FZD8 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18393
- Images (1)
| Article Name: | FZD8 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18393 |
| Supplier Catalog Number: | A18393 |
| Alternative Catalog Number: | ABB-A18393-20UL,ABB-A18393-100UL,ABB-A18393-1000UL,ABB-A18393-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | FZ-8, hFZ8, FZD8 |
| This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This gene is highly expressed in two human cancer cell lines, indicating that it may play a role in several types of cancer. The crystal structure of the extracellular cysteine-rich domain of a similar mouse protein has been determined. |
| Clonality: | Polyclonal |
| Molecular Weight: | 73kDa |
| NCBI: | 8325 |
| UniProt: | Q9H461 |
| Purity: | Affinity purification |
| Sequence: | PDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERA |
| Target: | FZD8 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FZD8 Rabbit pAb (A18393) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
