RHOBTB2 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18432
- Images (1)
| Article Name: | RHOBTB2 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18432 |
| Supplier Catalog Number: | A18432 |
| Alternative Catalog Number: | ABB-A18432-20UL,ABB-A18432-100UL,ABB-A18432-500UL,ABB-A18432-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | p83, DBC2, DEE64, EIEE64, RHOBTB2 |
| The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 83kDa |
| NCBI: | 23221 |
| UniProt: | Q9BYZ6 |
| Purity: | Affinity purification |
| Sequence: | MDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVF |
| Target: | RHOBTB2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat lung, using RHOBTB2 Rabbit pAb (A18432) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
