AAR2 Rabbit pAb, Polyclonal
Catalog Number:
ABB-A18443
- Images (1)
| Article Name: | AAR2 Rabbit pAb, Polyclonal |
| Biozol Catalog Number: | ABB-A18443 |
| Supplier Catalog Number: | A18443 |
| Alternative Catalog Number: | ABB-A18443-20UL,ABB-A18443-100UL,ABB-A18443-500UL,ABB-A18443-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Names: | CGI-23, C20orf4, AAR2 |
| This gene encodes the homolog of the yeast A1-alpha2 repressin protein that is involved in mRNA splicing. Alternately spliced transcript variants have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 43kDa |
| NCBI: | 25980 |
| UniProt: | Q9Y312 |
| Purity: | Affinity purification |
| Sequence: | MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFISEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSELPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQD |
| Target: | AAR2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using AAR2 Rabbit pAb (A18443) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
