DDB2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1848
- Images (1)
| Article Name: | DDB2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1848 |
| Supplier Catalog Number: | A1848 |
| Alternative Catalog Number: | ABB-A1848-100UL,ABB-A1848-20UL,ABB-A1848-1000UL,ABB-A1848-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | XPE, DDBB, UV-DDB2, DDB2 |
| This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 48kDa |
| NCBI: | 1643 |
| UniProt: | Q92466 |
| Purity: | Affinity purification |
| Sequence: | MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCD |
| Target: | DDB2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using DDB2 Rabbit pAb (A1848) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
